PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G1272
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 273aa    MW: 32657.7 Da    PI: 8.3349
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G1272genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix78.69e-2534116186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ qe+++ + +r e+++++ ++k++k lWe +s +mre+g++rs++qCk+kw+nl +ryk + + + +   ++++++p++d+l+
  Gh_D04G1272  34 QWSVQETKDFLMIRAELDQSFMETKRNKLLWEVISTRMREKGYNRSAEQCKCKWKNLFTRYKGCGTVDAE---TVRQQFPFYDELQ 116
                  7********************************************************************8...47788******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00183193IPR001005SANT/Myb domain
CDDcd122032.50E-233397No hitNo description
PfamPF138371.8E-2034118No hitNo description
PROSITE profilePS500907.2363591IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEGHHRHHHH HQQQHLQQQQ QPVSVNVEAD RFPQWSVQET KDFLMIRAEL DQSFMETKRN  60
KLLWEVISTR MREKGYNRSA EQCKCKWKNL FTRYKGCGTV DAETVRQQFP FYDELQAIFT  120
ARMQSVLCSE SEGGGATGSK KKAAQAQLSS DEEDDTEENE YSFRKKKKGK TGGGSSSKSG  180
SINIKEMLED FMRQQLQMEM QWREALESRE NERRMKEMEW RQTMEALENE RIMMERRWRE  240
REEQRRIREE ARAEKRDALI TALLNKLRRE DQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A2e-1235114786DNA binding protein GT-1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460704.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804501e-71TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A0D2V5A60.0A0A0D2V5A6_G
STRINGPOPTR_0006s10240.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.15e-51Trihelix family protein